PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00033573001
Common NameGSBRNA2T00033573001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 162aa    MW: 18460.2 Da    PI: 9.9553
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00033573001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31.1e-51141391128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrF Ptdeel+v+yL++k++g +++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk
  GSBRNA2T00033573001  14 LPPGFRFYPTDEELMVQYLCRKAAGYDFSL-QLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDK 102
                          79***************************9.89***************8888899*********************************99 PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           + + +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  GSBRNA2T00033573001 103 IIST-EGKRVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                          9988.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-609147IPR003441NAC domain
PROSITE profilePS5100553.44514161IPR003441NAC domain
PfamPF023652.2E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MGIQETDPLA QLSLPPGFRF YPTDEELMVQ YLCRKAAGYD FSLQLIAEID LYKFDPWVLP  60
NKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGKR VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLL EPSRANGSSK VTIQHANYLK N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10811517157NAC domain-containing protein 19
3swm_B1e-10811517157NAC domain-containing protein 19
3swm_C1e-10811517157NAC domain-containing protein 19
3swm_D1e-10811517157NAC domain-containing protein 19
3swp_A1e-10811517157NAC domain-containing protein 19
3swp_B1e-10811517157NAC domain-containing protein 19
3swp_C1e-10811517157NAC domain-containing protein 19
3swp_D1e-10811517157NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.111960.0bud| leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00033573001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667470.0KC966747.1 Brassica napus NAC transcription factor 19 (NAC19.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588383.11e-109PREDICTED: NAC domain-containing protein 19
RefseqXP_013703003.11e-109PREDICTED: NAC domain-containing protein 19
SwissprotQ9C9321e-108NAC19_ARATH; NAC domain-containing protein 19
TrEMBLA0A078GLM61e-118A0A078GLM6_BRANA; BnaC06g05920D protein
STRINGBra018998.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.11e-109NAC domain containing protein 19
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]